Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Transmembrane ascorbate ferrireductase 1(CYB561A)

Recombinant Arabidopsis thaliana Transmembrane ascorbate ferrireductase 1(CYB561A)

SKU:CSB-CF809253DOA

Regular price ¥274,500 JPY
Regular price Sale price ¥274,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8L856

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVRINAMAVTFVAHALAVIAAIMVLVWSISYRGGLAWEATNKNLIFNLHPVLMLIGFII LGGEAIISYKSLPLEKPVKKLIHLILHAIALALGIFGICAAFKNHNESHIPNLYSLHSWI GIGVISLYGFQWVYSFIVFFFPGGSTNLKSGLLPWHAMLGLFVYILAVGNAALGFLEKLT FLENGGLDKYGSEAFLINFTAIITILFGAFVVLTASAESPSPSPSVSNDDSVDFSYSAI

Protein Names:Recommended name: Transmembrane ascorbate ferrireductase 1 EC= 1.16.5.1 Alternative name(s): Cytochrome b561 Short name= Artb561-1 Short name= AtCytb561 Tonoplast Cyt-b561 Short name= TCytb

Gene Names:Name:CYB561A Synonyms:ACYB-2, CYBASC1 Ordered Locus Names:At4g25570 ORF Names:M7J2.60

Expression Region:1-239

Sequence Info:full length protein

View full details