Skip to product information
1 of 1

GeneBio Systems

Recombinant Arabidopsis thaliana Translationally-controlled tumor protein homolog (TCTP)

Recombinant Arabidopsis thaliana Translationally-controlled tumor protein homolog (TCTP)

SKU:P31265

Regular price ¥91,400 JPY
Regular price Sale price ¥91,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P31265

Gene Names: TCTP1

Alternative Name(s): TCTP1

Abbreviation: Recombinant Mouse-ear cress TCTP1 protein

Organism: Arabidopsis thaliana (Mouse-ear cress)

Source: E.coli

Expression Region: 1-168aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFAHGLKEVKC

MW: 25.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: General regulator required for the development of the entire plant. Regulates the duration of cell cycle. Probable activator of Rab GTPases and upstream regulator of the cell growth-regulating TOR (target of rapamycin) network. Might also control spatial growth in pollen tubes or root hairs via the TORC2 signaling branch. Involved in the regulation of abscisic acid- and calcium-mediated stomatal closure, but not in light or H(+)-pumping induced stomatal opening. May regulate microtubules depolymerization. Binds calcium and has a cytoprotective function.

Reference:

Function:

View full details