Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 2(SCAMP2)

Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 2(SCAMP2)

SKU:CSB-CF862851DOA

Regular price ¥293,300 JPY
Regular price Sale price ¥293,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LR68

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARHDPNPFADEEINPFANHTSVPPASNSYLKPLPPEPYDRGATVDIPLDSGNDLRAKEM ELQAKENELKRKEQELKRREDAIARTGVVIEEKNWPEFFPLIHHDIPNEIPIHLQKIQYV AFTTLLGLVGCLLWNIVAVTVAWIKGEGPTIWLLSIIYFLAGVPGAYVLWYRPLYRATRT DSALKFGAFFFFYVFHIAFCGFAAVAPPVIFQGKSLTGFLPAIELLTTNAAVGIMYFIGA GFFCIETLLNIWVIQQVYAYFRGSGKAAEMKREATKSTLMRAL

Protein Names:Recommended name: Secretory carrier-associated membrane protein 2 Short name= AtSC2 Short name= Secretory carrier membrane protein 2

Gene Names:Name:SCAMP2 Synonyms:SC2 Ordered Locus Names:At1g03550 ORF Names:F21B7.17

Expression Region:1-283

Sequence Info:full length protein

View full details