Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL80(ATL80)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL80(ATL80)

SKU:CSB-CF881752DOA

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LM69

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARLLFRLLVESNTPSPAIDNSTAALNSDLVVILAALLCALICVLGLIAVSRCVWLRRLA AGNRTVSGSQTQSPQPPVAAANKGLKKKVLQSLPKLTFSPESPESEKFAECAICLAEFSA GDELRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCHKCGGLPGSSSSGLESEPE IEIRIKQGEDDPNSFLP

Protein Names:Recommended name: RING-H2 finger protein ATL80

Gene Names:Name:ATL80 Ordered Locus Names:At1g20823 ORF Names:F2D10.34

Expression Region:1-197

Sequence Info:full length protein

View full details