Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL44(ATL44)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL44(ATL44)

SKU:CSB-CF522788DOA

Regular price ¥274,800 JPY
Regular price Sale price ¥274,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O22755

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTRPSRLLETAAPPPQPSEEMIAAESDMVVILSALLCALICVAGLAAVVRCAWLRRFTAG GDSPSPNKGLKKKALQSLPRSTFTAAESTSGAAAEEGDSTECAICLTDFADGEEIRVLPL CGHSFHVECIDKWLVSRSSCPSCRRILTPVRCDRCGHASTAEMKDQAHRHQHHQHSSTTI PTFLP

Protein Names:Recommended name: RING-H2 finger protein ATL44 Alternative name(s): RING-H2 zinc finger protein RHA3a

Gene Names:Name:ATL44 Synonyms:RHA3A Ordered Locus Names:At2g17450 ORF Names:F5J6.22, MJB20

Expression Region:1-185

Sequence Info:full length protein

View full details