Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Putative defensin-like protein 70(LCR83)

Recombinant Arabidopsis thaliana Putative defensin-like protein 70(LCR83)

SKU:CSB-YP306814DOA

Regular price ¥209,300 JPY
Regular price Sale price ¥209,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P82792

Gene Names: LCR83

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT

Expression Region: 28-82aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal GST-tagged

MW: 32.9 kDa

Alternative Name(s): Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83

Relevance:

Reference: "Genome organization of more than 300 defensin-like genes in Arabidopsis."Silverstein K.A.T., Graham M.A., Paape T.D., VandenBosch K.A. Plant Physiol. 138:600-610(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details