Gene Bio Systems
Recombinant Arabidopsis thaliana Putative cytochrome c biogenesis ccmF C-terminal-like mitochondrial protein 3(CCMFN2)
Recombinant Arabidopsis thaliana Putative cytochrome c biogenesis ccmF C-terminal-like mitochondrial protein 3(CCMFN2)
SKU:CSB-CF654946DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q33884
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VDTGREQAKRVVRNGKKETTTLPLCWTAGANTVVSDQDQEPIRIWILTCWWFLTVGILLG SWWAYHELGWGGWWFWDPVENASFMPWVLATACIHSVILPFLHSWTLFLNIVTFLCCVLG TFSIRSGLLASVHSFATDDTRGIFLWWFFLLMTGIFMILFYQMKQQASVRRTYKKEMVVA RSTLVHLRHSARAQPRPVMLWKN
Protein Names:Recommended name: Putative cytochrome c biogenesis ccmF C-terminal-like mitochondrial protein 3
Gene Names:Name:CCMFN2 Synonyms:CC6BN2, CCB203 Ordered Locus Names:AtMg00960
Expression Region:1-203
Sequence Info:full length protein
