Gene Bio Systems
Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic(TIC20-V)
Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic(TIC20-V)
SKU:CSB-CF861846DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9FM67
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QSKGDDSVDASDRIISAVCYFYPFFDGIQYGKFIITQYQPFQILIQPLFPAIRAFKSFPF NGFLIFITLYFVVVRNPNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPRDGFGLDVVMS LDSTVFLFLLVSLIYGFSACLFGLTPRLPLVAEAADRQVL
Protein Names:Recommended name: Protein TIC 20-v, chloroplastic Alternative name(s): Translocon at the inner envelope membrane of chloroplasts 20-V Short name= AtTIC20-v
Gene Names:Name:TIC20-V Ordered Locus Names:At5g55710 ORF Names:MDF20.15
Expression Region:50-209
Sequence Info:full length protein
