Gene Bio Systems
Recombinant Arabidopsis thaliana Protein TIC 20-I, chloroplastic(TIC20-I)
Recombinant Arabidopsis thaliana Protein TIC 20-I, chloroplastic(TIC20-I)
SKU:CSB-CF814106DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8GZ79
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LSYLSASSSLLLNGEQGSLSGTLPVLPVRRKTLLTPRASKDVPSSFRFPPMTKKPQWWWR TLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFFVAYLG IVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSKWMPLGVYWGKFGMHFWTAVAFAYLFTV LESIRCALAGMYADIPFVCDAAYIQIPYD
Protein Names:Recommended name: Protein TIC 20-I, chloroplastic Alternative name(s): Translocon at the inner envelope membrane of chloroplasts 20-I Short name= AtTIC20-I
Gene Names:Name:TIC20-I Ordered Locus Names:At1g04940 ORF Names:F13M7.5, F13M7.7
Expression Region:66-274
Sequence Info:full length protein
