Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein TIC 20-I, chloroplastic(TIC20-I)

Recombinant Arabidopsis thaliana Protein TIC 20-I, chloroplastic(TIC20-I)

SKU:CSB-CF814106DOA

Regular price ¥279,300 JPY
Regular price Sale price ¥279,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GZ79

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSYLSASSSLLLNGEQGSLSGTLPVLPVRRKTLLTPRASKDVPSSFRFPPMTKKPQWWWR TLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFFVAYLG IVRRKEWPHFFRFHVVMGMLLEIALQVIGTVSKWMPLGVYWGKFGMHFWTAVAFAYLFTV LESIRCALAGMYADIPFVCDAAYIQIPYD

Protein Names:Recommended name: Protein TIC 20-I, chloroplastic Alternative name(s): Translocon at the inner envelope membrane of chloroplasts 20-I Short name= AtTIC20-I

Gene Names:Name:TIC20-I Ordered Locus Names:At1g04940 ORF Names:F13M7.5, F13M7.7

Expression Region:66-274

Sequence Info:full length protein

View full details