Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein-S-isoprenylcysteine O-methyltransferase A(ICMTA)

Recombinant Arabidopsis thaliana Protein-S-isoprenylcysteine O-methyltransferase A(ICMTA)

SKU:CSB-CF866990DOA

Regular price ¥277,000 JPY
Regular price Sale price ¥277,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FMW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEIFSDTSIRQLSQMLLSLIFFHISEYILAITIHGASNVTLSSLLITKHYALAMLLSLL EYLTEIILFPGLKQHWWVSNFGLIMIIVGEIIRKAAIITAGRSFTHLIKINYEEHHGLVT HGVYRLMRHPSYCGFLIWSVGTQVMLCNPVSAVAFAVVVWRFFAQRIPYEEYFLNQFFGV QYLEYAESVASGVPFVN

Protein Names:Recommended name: Protein-S-isoprenylcysteine O-methyltransferase A Short name= AtICMTA EC= 2.1.1.100 Alternative name(s): Isoprenylcysteine carboxylmethyltransferase A Prenylated protein carboxyl methyltransferase A Prenylcy

Gene Names:Name:ICMTA Synonyms:PCM, STE14, STE14A Ordered Locus Names:At5g23320 ORF Names:MKD15.18

Expression Region:1-197

Sequence Info:full length protein

View full details