Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A2(PP2A2)

Recombinant Arabidopsis thaliana Protein PHLOEM PROTEIN 2-LIKE A2(PP2A2)

SKU:CSB-CF529322DOA

Regular price ¥276,200 JPY
Regular price Sale price ¥276,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O81866

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRVKRRKTVSCCTREISQLHGQSLKQINIGVGSLILTKHQGYEFYCKKVTFVFFCFFKIS LNSAYLYTLYSDVRTEVAKMERVAWLEVVGKFETEKLTPNSLYEVVFVVKLIDSAKGWDF RVNFKLVLPTGETKERRENVNLLERNKWVEIPAGEFMISPEHLSGKIEFSMLEVKSDQWK SGLIVKGVAIRPKN

Protein Names:Recommended name: Protein PHLOEM PROTEIN 2-LIKE A2 Short name= AtPP2-A2

Gene Names:Name:PP2A2 Ordered Locus Names:At4g19850 ORF Names:T16H5.210

Expression Region:1-194

Sequence Info:full length protein

View full details