Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein A1(PRA1A1)

Recombinant Arabidopsis thaliana PRA1 family protein A1(PRA1A1)

SKU:CSB-CF862943DOA

Regular price ¥279,200 JPY
Regular price Sale price ¥279,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LZM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFI MIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVRRFSPQLAAKMRPP LTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLVSFALWYISSGLLRVSVALLIAHLATILH ASLRTPNLKARFNTFREEFRAVWRNYSEI

Protein Names:Recommended name: PRA1 family protein A1 Short name= AtPRA1.A1

Gene Names:Name:PRA1A1 Ordered Locus Names:At5g02040 ORF Names:T7H20.90

Expression Region:1-209

Sequence Info:full length protein

View full details