Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit VI-1, chloroplastic(PSAH1)

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit VI-1, chloroplastic(PSAH1)

SKU:CSB-CF886784DOA

Regular price ¥257,600 JPY
Regular price Sale price ¥257,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SUI7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILG GGSLLTYVSATSTGEVLPIKRGPQEPPKLGPRGKL

Protein Names:Recommended name: Photosystem I reaction center subunit VI-1, chloroplastic Alternative name(s): PSI-H1

Gene Names:Name:PSAH1 Ordered Locus Names:At3g16140 ORF Names:MSL1.18

Expression Region:51-145

Sequence Info:full length protein

View full details