Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit psaK, chloroplastic(PSAK)

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit psaK, chloroplastic(PSAK)

SKU:CSB-CF871170DOA

Regular price ¥255,500 JPY
Regular price Sale price ¥255,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SUI5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKATAGLRLEARDSGLQTGDPAGFTLADT LACGTVGHIIGVGVVLGLKNIGAI

Protein Names:Recommended name: Photosystem I reaction center subunit psaK, chloroplastic Alternative name(s): PSI-K Photosystem I subunit X

Gene Names:Name:PSAK Ordered Locus Names:At1g30380 ORF Names:T4K22.2

Expression Region:47-130

Sequence Info:full length protein

View full details