Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11C(PEX11C)

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11C(PEX11C)

SKU:CSB-CF867987DOA

Regular price ¥283,200 JPY
Regular price Sale price ¥283,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LQ73

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTLETTRAELGLVVVYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKNTSLARKVF RLFKFVNDLHALISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRTGIYKDKERAE ILGRISLFCWMGSSVCTSLVEVGELGRLSASIKKLEKEIGNKDKHQNEQYRAKVEKSNER SLALIKAGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPSHPKSKMV

Protein Names:Recommended name: Peroxisomal membrane protein 11C Alternative name(s): Peroxin-11C Short name= AtPEX11c

Gene Names:Name:PEX11C Synonyms:PEX11-1 Ordered Locus Names:At1g01820 ORF Names:T1N6.24

Expression Region:1-235

Sequence Info:full length protein

View full details