Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11B(PEX11B)

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11B(PEX11B)

SKU:CSB-CF871163DOA

Regular price ¥281,700 JPY
Regular price Sale price ¥281,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9STY0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLDTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRK AFRTGRSLTGFNALRRNPGATPMIRFLAVLANSGEMVYFFFDHFLWLSRIGSIDAKLAKK MSFISAFGESFGYTFFIIIDCIFIKQRLKSLKKLQHSTDEPKEEIGAKISEIRGDIVMRL MGISANVADLLIALAEIHPNPFCNHTITLGISGLVSAWAGWYRNWPS

Protein Names:Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Short name= AtPEX11b

Gene Names:Name:PEX11B Synonyms:PEX11-4 Ordered Locus Names:At3g47430 ORF Names:T21L8.180

Expression Region:1-227

Sequence Info:full length protein

View full details