Gene Bio Systems
Recombinant Arabidopsis thaliana Outer envelope pore protein 16-4, chloroplastic(OEP164)
Recombinant Arabidopsis thaliana Outer envelope pore protein 16-4, chloroplastic(OEP164)
SKU:CSB-CF864901DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LZH8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEEELLSAVPCSSLTVESVLRVATAGGLYGLCAGPRDARKIGLSGVSQASFVAKSIGRFG FQCGLVSGVFTMTHCGLQRYRGKNDWVNALVGGAVAGAAVAISTRNWTQVVGMAGLVSAF SVLANCTRTENPNNTN
Protein Names:Recommended name: Outer envelope pore protein 16-4, chloroplastic Alternative name(s): Chloroplastic outer envelope pore protein of 16 kDa 4 Short name= AtOEP16-4 Short name= OEP16-4
Gene Names:Name:OEP164 Ordered Locus Names:At3g62880 ORF Names:F26K9.310
Expression Region:1-136
Sequence Info:full length protein
