Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Oleosin 21.2 kDa(At5g40420)

Recombinant Arabidopsis thaliana Oleosin 21.2 kDa(At5g40420)

SKU:CSB-CF657190DOA

Regular price ¥276,500 JPY
Regular price Sale price ¥276,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q39165

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADTHRVDRTDRHFQFQSPYEGGRGQGQYEGDRGYGGGGYKSMMPESGPSSTQVLSLLIGV PVVGSLLALAGLLLAGSVIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGL SSISWVMNYLRGTRRTVPEQLEYAKRRMADAVGYAGQKGKEMGQHVQNKAQDVKQYDISK PHDTTTKGHETQGRTTAA

Protein Names:Recommended name: Oleosin 21.2 kDa Alternative name(s): Oleosin type 2

Gene Names:Ordered Locus Names:At5g40420 ORF Names:MPO12.17

Expression Region:2-199

Sequence Info:full length protein

View full details