Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana NEP1-interacting protein-like 2(ATL24)

Recombinant Arabidopsis thaliana NEP1-interacting protein-like 2(ATL24)

SKU:CSB-CF818517DOA

Regular price ¥280,800 JPY
Regular price Sale price ¥280,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8LBA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTTLSPAVEAEQIADSTIDTVSRLIAGVFSGALTGIFAMAGAFTGAVTGAVAGRAAQYG VLRGAALGAVAGAILSVEVLEASRAYWYLELSGSRGPSSMADFVEQLFRGRLVDEQLMST MINSHHWQLRISDVSYEEREDVYGELEARGLSGDSLRKLPCYIMSSEMVRRQVTHCTICL QDIKTGEITRSLPKCDHTFHLVCVDKWLIRHGSCPICRQAVKD

Protein Names:Recommended name: NEP1-interacting protein-like 2 Alternative name(s): RING-H2 finger protein ATL24

Gene Names:Name:ATL24 Ordered Locus Names:At1g74410 ORF Names:F1M20.9

Expression Region:1-223

Sequence Info:full length protein

View full details