Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL76(ATL76)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL76(ATL76)

SKU:CSB-CF754105DOA

Regular price ¥282,100 JPY
Regular price Sale price ¥282,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q6NML0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSANELPASAQSLQEQFLGSFVTRKLLLHDPFDHNSLRVFAVAPSPLITHENNLKGNVLM LLSVLICGIICCLGLHYIIRCAFRRSSRFMISEPISSLSTPRSSSNKGIKKKALRMFPVV SYSREMNLPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCL VETCQKILGDFSQADSMASTPTESVIVRIDPLEPEGRVNTFRESS

Protein Names:Recommended name: E3 ubiquitin-protein ligase ATL76 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein ATL76

Gene Names:Name:ATL76 Ordered Locus Names:At1g49210 ORF Names:F27J15.3

Expression Region:1-225

Sequence Info:full length protein

View full details