Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23(ATL23)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23(ATL23)

SKU:CSB-CF813165DOA

Regular price ¥270,400 JPY
Regular price Sale price ¥270,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8L9W3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHYTRISPALVPSLSPTAAAESSGGGTMIATVFMALLLPCVGMCIVFLIYLFLLWCSTRR RIERLRFAEPVKPVTGKGLSVLELEKIPKLTGRELAVIARSTECAVCLEDIESGQSTRLV PGCNHGFHQLCADTWLSNHTVCPVCRAELAPNLPQCNENQSPC

Protein Names:Recommended name: E3 ubiquitin-protein ligase ATL23 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein ATL23

Gene Names:Name:ATL23 Ordered Locus Names:At5g42200 ORF Names:MJC20.31

Expression Region:1-163

Sequence Info:full length protein

View full details