Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5(DRB5)

Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5(DRB5)

SKU:CSB-YP815439DOA

Regular price ¥209,200 JPY
Regular price Sale price ¥209,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: Q8GY79

Gene Names: DRB5

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Expression Region: 1-393aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 45.6 kDa

Alternative Name(s): dsRNA-binding protein 5 Short name: AtDRB5

Relevance: Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Reference: "Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.DNA Res. 5:41-54(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details