Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Copper transporter 1(COPT1)

Recombinant Arabidopsis thaliana Copper transporter 1(COPT1)

SKU:CSB-CF654393DOA

Regular price ¥270,600 JPY
Regular price Sale price ¥270,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q39065

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWP GTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLV MLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCAC

Protein Names:Recommended name: Copper transporter 1 Short name= AtCOPT1

Gene Names:Name:COPT1 Ordered Locus Names:At5g59030 ORF Names:K18B18.10, K18B18.2

Expression Region:1-170

Sequence Info:full length protein

View full details