Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.3, chloroplastic(LHCB4.3)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.3, chloroplastic(LHCB4.3)

SKU:CSB-CF874353DOA

Regular price ¥285,800 JPY
Regular price Sale price ¥285,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9S7W1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RFGFSFGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKPAE YLQYDFDGLDQNLAKNVAGDIIGIIQESSEIKPTPFQPYTEVFGIQRFRECELIHGRWAM LGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNS ELDPEKRIYPGGYFDPLGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPVS FLATFNN

Protein Names:Recommended name: Chlorophyll a-b binding protein CP29.3, chloroplastic Alternative name(s): LHCB4.3 LHCII protein 4.3

Gene Names:Name:LHCB4.3 Ordered Locus Names:At2g40100 ORF Names:F27I1.2

Expression Region:30-276

Sequence Info:full length protein

View full details