Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic(LHCB5)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic(LHCB5)

SKU:CSB-CF894027DOA

Regular price ¥282,700 JPY
Regular price Sale price ¥282,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9XF89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFA KYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIP INLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKN GRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL

Protein Names:Recommended name: Chlorophyll a-b binding protein CP26, chloroplastic Alternative name(s): LHCB5 LHCIIc Light-harvesting complex II protein 5

Gene Names:Name:LHCB5 Ordered Locus Names:At4g10340 ORF Names:F24G24.140

Expression Region:49-280

Sequence Info:full length protein

View full details