Gene Bio Systems
Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic(LHCB5)
Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP26, chloroplastic(LHCB5)
SKU:CSB-CF894027DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9XF89
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFA KYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIP INLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKN GRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL
Protein Names:Recommended name: Chlorophyll a-b binding protein CP26, chloroplastic Alternative name(s): LHCB5 LHCIIc Light-harvesting complex II protein 5
Gene Names:Name:LHCB5 Ordered Locus Names:At4g10340 ORF Names:F24G24.140
Expression Region:49-280
Sequence Info:full length protein
