Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At2g39518(At2g39518)

Recombinant Arabidopsis thaliana CASP-like protein At2g39518(At2g39518)

SKU:CSB-CF701127DOA

Regular price ¥272,800 JPY
Regular price Sale price ¥272,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q56X75

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPPPPSPPAVSLKVLLLLLRVLTGVFLVIALIILSTNSVTIVSQGSALKFHFKDVYAYR YMLSAAVIGLVYAVIQLFFTISEFATGVKNPFNYQLDFYGDKLISYLVATGSAAGFGVTK DLKDTFLALVALDSTDPVDKFFSKGYASASLLLFAFICLAVLSVFSSFAMAKRN

Protein Names:Recommended name: CASP-like protein At2g39518

Gene Names:Ordered Locus Names:At2g39518 ORF Names:F12L6

Expression Region:1-174

Sequence Info:full length protein

View full details