Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At1g49405(At1g49405)

Recombinant Arabidopsis thaliana CASP-like protein At1g49405(At1g49405)

SKU:CSB-CF660368DOA

Regular price ¥268,300 JPY
Regular price Sale price ¥268,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q3ECT8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVEVPGSVGTTASLSLRLGQMVLAFGSLLFMTIGVRFYQFTAFCYLVTIMSLAIPWNLTL AMVDIYCVILQQPFQKPRILLAISIGDWVVSVLALASASSAASVVDILRSNESSCPPTIC NRYQFAATLAFLTWFLSLSSSLFNLWLLPSLI

Protein Names:Recommended name: CASP-like protein At1g49405

Gene Names:Ordered Locus Names:At1g49405 ORF Names:F13F21.34

Expression Region:1-152

Sequence Info:full length protein

View full details