Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana 5'-adenylylsulfate reductase-like 4(APRL4)

Recombinant Arabidopsis thaliana 5'-adenylylsulfate reductase-like 4(APRL4)

SKU:CSB-CF879690DOA

Regular price ¥294,200 JPY
Regular price Sale price ¥294,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SA00

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VRVPFCATKSAKDSIFGLRDQTCSVSGVESDERPRFVAVTEGDERWLQIALDMIHKNKCD YVALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKESSIKPSTLSKYGVHGFPTLLLL NSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERSVSVPHLGNENNTEPENCPFTWA RSPENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKFTWRRIAQNMRLESLLEHTVGFL SRAVQLCMHRRSNLQGGAMNARAWASKSLATVSIGDSSSSNRRSSSSQ

Protein Names:Recommended name: 5'-adenylylsulfate reductase-like 4 Alternative name(s): Adenosine 5'-phosphosulfate reductase-like 4 Short name= APR-like 4 Short name= AtAPRL4

Gene Names:Name:APRL4 Ordered Locus Names:At1g34780 ORF Names:F11O6.7, F21H2.1

Expression Region:23-310

Sequence Info:full length protein

View full details