Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aquifex aeolicus UPF0056 membrane protein aq_540 (aq_540)

Recombinant Aquifex aeolicus UPF0056 membrane protein aq_540 (aq_540)

SKU:CSB-CF524703DNV

Regular price ¥272,700 JPY
Regular price Sale price ¥272,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aquifex aeolicus (strain VF5)

Uniprot NO.:O66819

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIITWMEEFGVLFVKAFLSLLAIMNPFSSVPVVISLMNEYSKEEIRVIALKASVYAFFIL TFFLISGDLLFRFMGITLPAFKVGGGILLFLIALNLVQGEVTKEKGKAHEIEAALRRDNI ALIPLAMPLLAGPGSITTVLVLRGYLNTLEGKVALFCAIFLSSFTAFVVYSLSTFFYRVL GRTGINLITRISGILLLAISVQFVVDGLKNLLKH

Protein Names:Recommended name: UPF0056 membrane protein aq_540

Gene Names:Ordered Locus Names:aq_540

Expression Region:1-214

Sequence Info:full length protein

View full details