Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ambrosia artemisiifolia Pectate lyase 5

Recombinant Ambrosia artemisiifolia Pectate lyase 5

SKU:CSB-YP329754BYC

Regular price ¥209,000 JPY
Regular price Sale price ¥209,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P27759

Gene Names: N/A

Organism: Ambrosia artemisiifolia (Short ragweed)

AA Sequence: AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQVVNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHGEAAAESMKWNWRTNKDVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC

Expression Region: 26-396aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 41.8 kDa

Alternative Name(s): Antigen Amb a I Antigen E Short name: AgE Pollen allergen Amb a 1.1 Allergen: Amb a 1.1

Relevance: Has pectate lyase activity.

Reference: "Sequence polymorphism of Amb a I and Amb a II, the major allergens in Ambrosia artemisiifolia (short ragweed)." Griffith I.J., Pollock J., Klapper D.G., Rogers B.L., Nault A.K. Int. Arch. Allergy Appl. Immunol. 96:296-304(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details