Skip to product information
1 of 1

Gene Bio Systems

Recombinant Alternaria alternata Heat shock 70KDA protein(HSP70)

Recombinant Alternaria alternata Heat shock 70KDA protein(HSP70)

SKU:CSB-EP302100AZV

Regular price ¥190,700 JPY
Regular price Sale price ¥190,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P78983

Gene Names: HSP70

Organism: Alternaria alternata (Alternaria rot fungus) (Torula alternata)

AA Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Expression Region: 1-152aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 20.2 kDa

Alternative Name(s): Allergen: Alt a 3

Relevance:

Reference: "Molecular cloning of IgE-binding fragments of Alternaria alternata allergens."De Vouge M.W., Thaker A.J., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 116:261-268(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details