Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aliivibrio salmonicida UPF0397 protein VSAL_I1988 (VSAL_I1988)

Recombinant Aliivibrio salmonicida UPF0397 protein VSAL_I1988 (VSAL_I1988)

SKU:CSB-CF469305AZM

Regular price ¥274,200 JPY
Regular price Sale price ¥274,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))

Uniprot NO.:B6EH91

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSAKTVVVIAIGAALYGIGGLPMFGIPVFANTTLKPAMAVLALFSVLYGPIVGFLVGF IGHWVTDLFAGWGVWLTWILGSGIVGMIIGLFPILTKRRIEVGLFDKKDFFIFVVLAFVG NVIGYGTSAFLDTVLYAEPFTKVFAQLCIIAAGNTVLIAVVGYFILTNLAKRKKQSTHLT EAQ

Protein Names:Recommended name: UPF0397 protein VSAL_I1988

Gene Names:Ordered Locus Names:VSAL_I1988

Expression Region:1-183

Sequence Info:full length protein

View full details