Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ailuropoda melanoleuca Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

Recombinant Ailuropoda melanoleuca Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

SKU:CSB-CF007694AYX

Regular price ¥315,500 JPY
Regular price Sale price ¥315,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ailuropoda melanoleuca (Giant panda)

Uniprot NO.:D2GZV9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATTWGAAFFMLVASCVCSTVFHRDQQTWFEGVFLSSMCPINVSASTLYGIMFDAGSTGTRIHIYTFVQKIPGQLPILEGEIFESVKPGLSAFVDQPKQGAETVEELLEVAKDSVPRSHWKRTPVVLKATAGLRLLPEQKAEALLFEVREIFRKSPFLVPDDSVSIMDGSYEGILAWVTVNFLTGQLHGHSQKTVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGIDGHTFRSACLPRWLEAEWIFGGVKYQYGGNKEGNEGSGEVGFEPCYAEVLRVVQGKLHQPDEVRKSSFYAFSYYYDRAADTDMIDYETGGVLKVEDFERKAREVCDNLEKFTSGSPFLCMDLSYITALLKDGFGFADSTILQLSKKVNNIETGWALGATFHLLQSLGISH

Protein Names:Recommended name: Ectonucleoside triphosphate diphosphohydrolase 5 Short name= NTPDase 5 EC= 3.6.1.6 Alternative name(s): Guanosine-diphosphatase ENTPD5 Short name= GDPase ENTPD5 EC= 3.6.1.42 Uridine-diphosphatase ENTPD5 Short name= UDPase ENTPD5

Gene Names:Name:ENTPD5 ORF Names:PANDA_002660

Expression Region:1-433

Sequence Info:full length protein

View full details