Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agrobacterium tumefaciens Uncharacterized protein Atu2659.1(Atu2659.1)

Recombinant Agrobacterium tumefaciens Uncharacterized protein Atu2659.1(Atu2659.1)

SKU:CSB-CF844906AYS

Regular price ¥259,700 JPY
Regular price Sale price ¥259,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Uniprot NO.:Q8U530

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSCNQDTEILMLALFQTIDLALNLYTWVLIASAIFSWLYAFNVINSRNQFVNAIGSFLVN VTEPALRPIRRILPNLGGIDISPIILLLIIFFIRSFMWNTLYPMTV

Protein Names:Recommended name: Uncharacterized protein Atu2659.1

Gene Names:Ordered Locus Names:Atu2659.1 ORF Names:AGR_C_4820

Expression Region:1-106

Sequence Info:full length protein

View full details