Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agrobacterium tumefaciens Probable intracellular septation protein A(Atu2692)

Recombinant Agrobacterium tumefaciens Probable intracellular septation protein A(Atu2692)

SKU:CSB-CF844919AYS

Regular price ¥271,000 JPY
Regular price Sale price ¥271,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Uniprot NO.:Q8UC06

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVAEISPLLKFVLELGPLMVFFFANSRGEWLASTFPVLTEFGGPIFIATGLFMIATATAL TVSWILTRKLPIMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGVILLGGLFFGQ SLLGYVFNSAFKLTDEGWRKLTLRWGVFFLFLAVLNEVVWRMFTTDTWVAFKVWGTMPIT IIFTMAQMPFVMRHSVEPLGKDEK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Atu2692 ORF Names:AGR_C_4880.1

Expression Region:1-204

Sequence Info:full length protein

View full details