Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Uncharacterized protein B117L(Mal-091)

Recombinant African swine fever virus Uncharacterized protein B117L(Mal-091)

SKU:CSB-CF840819AYE

Regular price ¥255,100 JPY
Regular price Sale price ¥255,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Uniprot NO.:Q8V9S1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYTIQLDKDGDYYWDEDPTHHDPYMRANATSHAAASHAAASHAAASHAAAPHTAVHHAF HEPFIKLNLTDKNIFNGLGFILIVIFIYLLIITLQQMLTRHIYNTVQQCVKTHLDSKNLQ

Protein Names:Recommended name: Uncharacterized protein B117L Short name= pB117L

Gene Names:Ordered Locus Names:Mal-091

Expression Region:1-120

Sequence Info:full length protein

View full details