Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Protein MGF 110-13L (War-020)

Recombinant African swine fever virus Protein MGF 110-13L (War-020)

SKU:CSB-CF315302AEI

Regular price ¥262,800 JPY
Regular price Sale price ¥262,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)

Uniprot NO.:P0C9K0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGGGDYWPIIIRHCCFYLVFSIAFVGYIVFAYYKNLHLNTTMKLIALLCILIWLSQPGLN RPLSIFYMKQNLPRTYTPPIRELEYWCTYGKHCDFCWECRNGICKNKVWDDMPLIKQNDY ISQCSIARYFDRCMYFIKPKTPYIHYMDCSQPTAYKGFSH

Protein Names:Recommended name: Protein MGF 110-13L

Gene Names:Ordered Locus Names:War-020

Expression Region:1-160

Sequence Info:full length protein

View full details