Gene Bio Systems
Recombinant African swine fever virus Protein MGF 110-13L (Mal-018)
Recombinant African swine fever virus Protein MGF 110-13L (Mal-018)
SKU:CSB-CF316362AYE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Uniprot NO.:P0C9K1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGGGGDHQQLSIKQYCLYFIIGIAYTDCFICALCKNLRLSTTMKLFVLLSILVWLAQPVL NRPLSIFYTKQILPRTYTPPMRELEYWCTYGKHCDFCWDCKNGICKNKVLDDMPLIVQND YISKCSITRFIDRCMYFIEPKIPYIHYMNCSLPTYFS
Protein Names:Recommended name: Protein MGF 110-13L
Gene Names:Ordered Locus Names:Mal-018
Expression Region:1-157
Sequence Info:full length protein
