Gene Bio Systems
Recombinant African swine fever virus Protein H108R (Pret-129)
Recombinant African swine fever virus Protein H108R (Pret-129)
SKU:CSB-CF315478AYG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Uniprot NO.:P0CA14
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVNLFPVFTLIVIITILITTRELSTTMLIVSLVTDYIIINTQYTEQQHENNTFSMPQKNS FSESYNKDKKSNTHIPYQWLAPELKEAESKYWWGNYDPHSEPVLAGAS
Protein Names:Recommended name: Protein H108R Short name= pH108R
Gene Names:Ordered Locus Names:Pret-129
Expression Region:1-108
Sequence Info:full length protein
