Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aedes aegypti Protein KRTCAP2 homolog(AAEL007634)

Recombinant Aedes aegypti Protein KRTCAP2 homolog(AAEL007634)

SKU:CSB-CF626630AXQ

Regular price ¥263,700 JPY
Regular price Sale price ¥263,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Uniprot NO.:Q1HQF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVPTSVSLVLASVTAVLIFSAMQMYKPLIASSQMATVFGGFLGSWLFILSLTAVSNLEA VVLGKGFQAKLFPEVAFCLIGSLFACGMVHRVCATTCILFSVAALYYINRISQKVHNAPV PVDTYAGKKKKK

Protein Names:Recommended name: Protein KRTCAP2 homolog

Gene Names:ORF Names:AAEL007634

Expression Region:1-132

Sequence Info:full length protein

View full details