Gene Bio Systems
Recombinant Acinetobacter baumannii UPF0756 membrane protein ABBFA_001344 (ABBFA_001344)
Recombinant Acinetobacter baumannii UPF0756 membrane protein ABBFA_001344 (ABBFA_001344)
SKU:CSB-CF481835AWN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acinetobacter baumannii (strain AB307-0294)
Uniprot NO.:B7H133
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLAQFDVNLVVLLVLLICGLLSQNAAVTIAAGVLIVIKITPLNQFFPYIQAHGLNLGILI LTIGVLTPIASGKLSGESILKSFISFKSLVAIAIGLLVAWLGGRGVKLMSSQPDVVAGLL IGTVAGVALLRGVPVGPLIAAGLLSLFIGK
Protein Names:Recommended name: UPF0756 membrane protein ABBFA_001344
Gene Names:Ordered Locus Names:ABBFA_001344
Expression Region:1-150
Sequence Info:full length protein
