Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (Lferr_0816)

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (Lferr_0816)

SKU:CSB-CF470796AWI

Regular price ¥274,800 JPY
Regular price Sale price ¥274,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993))

Uniprot NO.:B5ENN2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGMLAITVIFVLFQAVVISRALPQEAKD GDSSA

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Lferr_0816

Expression Region:1-185

Sequence Info:full length protein

View full details