Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF116 (ORF116)

SKU:CSB-CF397888ATY

Regular price ¥252,600 JPY
Regular price Sale price ¥252,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)

Uniprot NO.:A4ZUB4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEYVEPLAPLYGGEYSTTGIVTLSVGIALLVLANAFAYALVKAFGIQSYYGRLLGGIVLL VLSMLLTLSTNSINKFRGAFTFAIGEIIIGGLDVINDKSGWSQPVVSPTVGCQGGA

Protein Names:Recommended name: Putative transmembrane protein ORF116

Gene Names:ORF Names:ORF116

Expression Region:1-116

Sequence Info:full length protein

View full details