Recombinant Accessory secretory protein Asp4(asp4)

SKU: CSB-CF679887SML

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Streptococcus gordonii

Uniprot NO.:Q4L2X3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKDLFHKDIEGRLDELKHGKPKKEKASLGENLNKIFVIALGLMILIGLIFTLIGALRK

Protein Names:Recommended name: Accessory secretory protein Asp4 Alternative name(s): Orf5

Gene Names:Name:asp4

Expression Region:1-60

Sequence Info:full length protein