Gene Bio Systems
Recombinant Accessory secretory protein Asp4(asp4)
Recombinant Accessory secretory protein Asp4(asp4)
SKU:CSB-CF679887SML
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptococcus gordonii
Uniprot NO.:Q4L2X3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKKDLFHKDIEGRLDELKHGKPKKEKASLGENLNKIFVIALGLMILIGLIFTLIGALRK
Protein Names:Recommended name: Accessory secretory protein Asp4 Alternative name(s): Orf5
Gene Names:Name:asp4
Expression Region:1-60
Sequence Info:full length protein
