Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acanthamoeba polyphaga mimivirus Putative TLC domain-containing protein L438(MIMI_L438)

Recombinant Acanthamoeba polyphaga mimivirus Putative TLC domain-containing protein L438(MIMI_L438)

SKU:CSB-CF729353ADAZ

Regular price ¥271,700 JPY
Regular price Sale price ¥271,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acanthamoeba polyphaga mimivirus (APMV)

Uniprot NO.:Q5UQN8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDYKQSNLFLFPIGLGSTYIFYKKICGTFCSIDNDLEVNPYLTHGILMLTLVYFLSDYYL MIVKYNPKHNVYFVHHFIGIVSIYFSYMKYYYLIKYLFAYLTFELSTPFLNIAIKYRNQG VYNKCSIFSELAFFILFTVVRIIFGTYLWFVTSNTLSSIEYPYNYLIVLPTILQFLNYWW YYRILKILRAKLFGCINKED

Protein Names:Recommended name: Putative TLC domain-containing protein L438

Gene Names:Ordered Locus Names:MIMI_L438

Expression Region:1-200

Sequence Info:full length protein

View full details