Skip to product information
1 of 1

Gene Bio Systems

Recombinant Absidia glauca Actin-1(ACT1)

Recombinant Absidia glauca Actin-1(ACT1)

SKU:CSB-EP320814AAD

Regular price ¥140,400 JPY
Regular price Sale price ¥140,400 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Epigenetics and Nuclear Signaling

Target / Protein: ACT1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Absidia glauca (Pin mould)

Delivery time: 3-7 business days

Uniprot ID: P10982

AA Sequence: MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-140aa

Protein length: Full Length

MW: 21.2 kDa

Alternative Name(s):

Relevance: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Reference:

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details