Skip to product information
1 of 1

GeneBio Systems

PLT conjugated BSA, General species

PLT conjugated BSA, General species

SKU:CPV770Ge11

Regular price ¥102,900 JPY
Regular price Sale price ¥102,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 50ug

Featured Series: Conjugated small molecules

Lead time: 7-10 days

Target Name: PLT

Target Full Name: Pramlintide

Alternative Names: Symlin

Species: General species

Expression System: Protein conjugation

Host: -

Uniprot ID: -

Gene ID: -

Region: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-(NH2)

Molecular Weight: -

Tags: Non Tag

Endotoxin Level: <1.0EU per 1µg (determined by the LAL method)

Isoelectric Point: -

Storage: Store at 2-8°C for one month,-80°C for 12 months

Expiration: Stable for 12 months if correctly stored.

Buffer: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300

State: Freeze-dried powder

Purity: ≥90%

Conjugation: BSA

Application: Immunogen; SDS-PAGE; WB

Subcellular Location: -

Research Area:

Reference: -

View full details