Anti-SARS-CoV-2 ORF8 Antibody

SKU: A33995

Size: 100 μg

Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Form: Lyophilized

Reactivity: Human

Applications: ELISA

Application Details: ELISA, 0.001-0.1μg/ml, Human

Gene Name: 8

Specificity:

Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.

Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Clonality: Polyclonal

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Purification: Immunogen affinity purified.

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Reference: 1. Gordon DE, et al. Nature, 2020 Jul. 2. Gordon DE, et al. Science, 2020 Oct 15. 3. Li JY, et al. Virus Res, 2020 Sep. 4. Wu F, et al. Nature, 2020 Mar.

Uniprot ID: P0DTC8

Host: Rabbit

Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Conjugate:

Cross Reactivity:

Isotype: Rabbit IgG

Phospho_site:

Clone Number:

Observed Molecular Weight: 140 kDa, 130 kDa, 110 kDa

Calculated Molecular Weight: 16693 MW

Gene ID: 43740577

Protein Name: ORF8 protein

Gene Full Name: ORF8 protein

Synonyms: ORF8 protein; ORF8; Non-structural protein 8; ns8