Skip to product information
1 of 1

Gene Bio Systems

RecombinantMouseAquaporin-4(Aqp4),partial

RecombinantMouseAquaporin-4(Aqp4),partial

SKU:CSB-YP001964MO1

Regular price £677.00 GBP
Regular price Sale price £677.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P55088

Gene Names: Aqp4

Organism: Mus musculus (Mouse)

AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Expression Region: 253-323aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 9.9 kDa

Alternative Name(s): Mercurial-insensitive water channel

Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Reference: "Defective secretion of saliva in transgenic mice lacking aquaporin-5 water channels." Ma T., Song Y., Gillespie A., Carlson E.J., Epstein C.J., Verkman A.S. J. Biol. Chem. 274:20071-20074(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details