Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Photosystem I reaction center subunit VI, chloroplastic(PSAH)

Recombinant Zea mays Photosystem I reaction center subunit VI, chloroplastic(PSAH)

SKU:CSB-CF527719ZAX

Regular price £1,073.00 GBP
Regular price Sale price £1,073.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:O65101

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YGDKSVYFDLDDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGG GSLLAYVSASASPDLLPIKKGPQEPPQPGPRGKI

Protein Names:Recommended name: Photosystem I reaction center subunit VI, chloroplastic Short name= PSI-H Alternative name(s): Light-harvesting complex I 11 kDa protein

Gene Names:Name:PSAH

Expression Region:49-142

Sequence Info:full length protein

View full details